PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0099s0106.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 358aa    MW: 38764.5 Da    PI: 6.861
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0099s0106.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA572.6e-18264297134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C++C  tkTp+WR gp g+ktLCnaCG+++++ +
  Kaladp0099s0106.1.p 264 CQHCEITKTPQWRAGPMGPKTLCNACGVRFKSGR 297
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-754354IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.213258294IPR000679Zinc finger, GATA-type
SMARTSM004012.3E-16258308IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-14262321No hitNo description
Gene3DG3DSA:3.30.50.101.1E-14262295IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.22E-14263320No hitNo description
PROSITE patternPS003440264289IPR000679Zinc finger, GATA-type
PfamPF003206.4E-16264297IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAGAGPSFAD DLDCVNFFDQ IDDLLDFPDE SCKNNGESGI LCEDFKDFPS VWTQSDPFPA  60
SESVFSGSNS NSTSDLSAEL SVPYEDIAEL EWLSTFVEDS FSAGNSLTID VTNSVSNKVV  120
SPSPNQFQTS SPVSVLESSS SSYGGGKVMP VIPFKPAAMT GGRCGRARSK RPRPSTFNPR  180
PSMQLMSPNA SFTKTATPFE GVRTGCAEFN SFSELGHSLK IPKSSASMEC KKKKKMKLSV  240
PRPAEVNQNE NPNPLSPQVA VRKCQHCEIT KTPQWRAGPM GPKTLCNACG VRFKSGRLFP  300
EYRPAASPTF VPSVHSNSHK KVLEMRVKTC NRTGSPPSFE TLQTELVPNE NNVADYV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169173KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877217.11e-108PREDICTED: GATA transcription factor 8-like isoform X2
SwissprotQ9SV303e-41GATA8_ARATH; GATA transcription factor 8
TrEMBLB9HUF81e-108B9HUF8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s23010.11e-107(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.26e-42GATA family protein